PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_5309F1C77.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YC
Protein Properties Length: 410aa    MW: 42221.9 Da    PI: 10.8444
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_5309F1C77.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC26.21.7e-083173942097
                  NF-YC  20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97 
                            ++P+ar++ +++  +   +   ea  l+ ka elf+  ++  +  +a + +++++   ++++av + + ++fl d vp
  Traes_5BL_5309F1C77.1 317 SFPMARVRLLMRDKDATIRSNNEAVFLVNKASELFLEVFAKDAHQNALKERKKSITYENLSSAVCNEKRYKFLSDFVP 394
                            79*******9997777777889999**********98888899999999***************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR009298.6E-82838IPR017956AT hook, DNA-binding motif
PRINTSPR009298.6E-84859IPR017956AT hook, DNA-binding motif
PRINTSPR009298.6E-86575IPR017956AT hook, DNA-binding motif
SuperFamilySSF471136.01E-14316395IPR009072Histone-fold
PfamPF008081.0E-10317380IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.8E-17318394IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MAGKKQAAVS AAPSEGEEGA VVPSSTAKRG AGRPKKDPVP AAASPGSAAK RGPGKPKKDP  60
VPAAAAKRGS GRPKKGAAPA ESGEGSAPEP GKSEMGEGEK GATPKKQGKG EKEKAATPKK  120
KKEKGDKPAN LEKKKKGDAA ATPKKKEKKG GEAAEPGSGS GKQEPSGEAG KPKPTPKKTK  180
QQASDGAAKE TPSKRKRDDA GEPQPQKAAK KADKATPTKK KQASSGGAEK ATTPSKTPQK  240
EAKSAKKSPG KAEKATPTKK QQASGGAEKA TPSKRKHGDL ESPNAAKSGQ NGSSPAKKQK  300
GKAAGATPVA AEPGTCSFPM ARVRLLMRDK DATIRSNNEA VFLVNKASEL FLEVFAKDAH  360
QNALKERKKS ITYENLSSAV CNEKRYKFLS DFVPLRVTAG DALKAVAKEP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119135KKKEKGDKPANLEKKKK
2173180PTPKKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3683111e-115AK368311.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2071P07.
GenBankAK3741801e-115AK374180.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3056O15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5FBF70.0W5FBF7_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128261922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-23nuclear factor Y, subunit C10
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]